General Information

  • ID:  hor005321
  • Uniprot ID:  P29203
  • Protein name:  Peptide YY-like (PYY)
  • Gene name:  PYY
  • Organism:  Gallus gallus (Chicken)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Gallus (genus), Phasianinae (subfamily), Phasianidae (family), Galliformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AYPPKPESPGDAASPEEIAQYFSALRHYINLVTRQRY
  • Length:  37(1-37)
  • Propeptide:  AYPPKPESPGDAASPEEIAQYFSALRHYINLVTRQRY
  • Signal peptide:  NA
  • Modification:  T37 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility
  • Mechanism:  NA
  • Cross BBB:  NO
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P29203-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P29203-F1.pdbhor005321_AF2.pdbhor005321_ESM.pdb

Physical Information

Mass: 487900 Formula: C192H288N52O57
Absent amino acids: CMW Common amino acids: AP
pI: 7.52 Basic residues: 5
Polar residues: 10 Hydrophobic residues: 11
Hydrophobicity: -78.92 Boman Index: -7848
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 63.51
Instability Index: 8972.16 Extinction Coefficient cystines: 5960
Absorbance 280nm: 165.56

Literature

  • PubMed ID:  1446739
  • Title:  The primary structure of a PYY-related peptide from chicken intestine suggests an anomalous site of cleavage of the signal peptide in preproPYY.